PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018918.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 806aa    MW: 89880.7 Da    PI: 5.1923
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018918.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS358.51e-1094298021373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL+ cA+avs++d++ +++lL++++++asp+gd  qRla++f+++L+ar+a++++++ k  ++ ++ +++ +++l+++++   ++P+ +++ l  
  Pbr018918.1 429 LRNLLILCAQAVSTNDFRTTSELLKQVRQHASPNGDGSQRLAHFFANGLEARMAGTGTGTQKFYTSLAK-RSSAVDVLKSYQVHLSACPFKRMCMLFK 525
                  6899***************************************************99999876655555.588999********************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N++Il+ +e+++++Hi+Df+i +G+QWp L+q L++R +gpp+lRiTg++ p++g   +e +eetg+rL +++e++gvpfe+n+++++++e+++l +L
  Pbr018918.1 526 NKMILKMAEKATTLHIVDFGILYGFQWPILIQHLSKRHGGPPKLRITGIEVPQPGfrPAECIEETGRRLGRYCERFGVPFEYNAVASQNWESIQLADL 623
                  ******************************************************9*99**************************9999********** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +++++E+laVn++l+ ++llde+v+ + +rd+vL+l+++++P+++v++  + ++n++ F++rf eal +ys+l+d+++ ++pr++eer   E e+ gr
  Pbr018918.1 624 KTERNEVLAVNCMLRFKNLLDETVEENCPRDAVLNLIRKMKPDIFVHSIINGSYNAPFFVTRFREALFHYSSLYDAFDINIPRDNEERLGFESEFYGR 721
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  e++nv+aceg er+er et+++W+ r ++aG++p++l+++ +k  k  ++  + + + v+++s+++++gWk+r +++ S+W
  Pbr018918.1 722 EAMNVIACEGVERVERPETYKQWQVRCMRAGLQPLQLDQDLVKILKDKVKAWYHKDFVVDQDSDWMLQGWKGRIVYASSCW 802
                  *****************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.544403783IPR005202Transcription factor GRAS
PfamPF035143.5E-107429802IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 806 aa     Download sequence    Send to blast
MDHPTVNGSP DYLNGFSIDD LAFSPDLTQF SNLTNEYQFN QFSPDLNFMD NQFSLPPDFE  60
QGNIVPEVSL TTSGESFVPS KSLSPPDGGS LSLPTTVSVG GADSSSDDSD FSEAIFKYAN  120
QILLEENIEK KPCMFFDPLG LRVTEKSFYD VLGQQYPFSP NQQPLHINPN VESPDGNISG  180
NCSDCSGSNR SSSPGTSNSI DPQWVGDSGE QKPSFPQTSL PNDSPFQFNS HSSSQLSVPL  240
ENRMTSVGDG QHVGDMLQGS SAEEFVAQNI FTDSDSILQF QRGLEEASKF LPKSTQLLVD  300
LESNTVSPEV KANVPIVTVK KEKSERKNSP NGSKGRKNRE REDVDLEEGR SSKQSAVYIE  360
KTEESELSEM FDKVLLSTGG NNESQCDSVA FKNEASKTLQ PSGQPQGSNG NGGKARGKKQ  420
GKKKETVDLR NLLILCAQAV STNDFRTTSE LLKQVRQHAS PNGDGSQRLA HFFANGLEAR  480
MAGTGTGTQK FYTSLAKRSS AVDVLKSYQV HLSACPFKRM CMLFKNKMIL KMAEKATTLH  540
IVDFGILYGF QWPILIQHLS KRHGGPPKLR ITGIEVPQPG FRPAECIEET GRRLGRYCER  600
FGVPFEYNAV ASQNWESIQL ADLKTERNEV LAVNCMLRFK NLLDETVEEN CPRDAVLNLI  660
RKMKPDIFVH SIINGSYNAP FFVTRFREAL FHYSSLYDAF DINIPRDNEE RLGFESEFYG  720
REAMNVIACE GVERVERPET YKQWQVRCMR AGLQPLQLDQ DLVKILKDKV KAWYHKDFVV  780
DQDSDWMLQG WKGRIVYASS CWVPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-444338028374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375904.10.0PREDICTED: scarecrow-like protein 33
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5WK680.0M5WK68_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14